Recombinant Human GLI2 protein, His-tagged

• Cat.No.: GLI2-3852H
• Product Overview: Recombinant Human GLI2 protein(601-795 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 601-795 aa
• AA Sequence: NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPAGLLPNPRLSELSASE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GLI2 GLI family zinc finger 2 [ Homo sapiens ]
• Official Symbol: GLI2
• Synonyms: GLI2; GLI family zinc finger 2; GLI Kruppel family member GLI2 , glioma associated oncogene family zinc finger 2; zinc finger protein GLI2; HPE9; tax helper protein 1; tax helper protein 2; tax responsive element 2 holding protein; THP1; THP2; oncogene GLI2; GLI-Kruppel family member GLI2; tax-responsive element-2 holding protein; glioma-associated oncogene family zinc finger 2; tax-responsive element-25-bp sequence binding protein
• Gene ID: 2736
• mRNA Refseq: NM_005270
• Protein Refseq: NP_005261
• MIM: 165230
• UniProt ID: P10070