Recombinant Human GLI2 Protein (412-641 aa), His-tagged
Cat.No. : | GLI2-2038H |
Product Overview : | Recombinant Human GLI2 Protein (412-641 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 412-641 aa |
Description : | Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.5 kDa |
AA Sequence : | EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | GLI2 GLI family zinc finger 2 [ Homo sapiens ] |
Official Symbol | GLI2 |
Synonyms | GLI2; GLI family zinc finger 2; HPE9; tax helper protein 1; tax helper protein 2; oncogene GLI2; |
Gene ID | 2736 |
mRNA Refseq | NM_005270 |
Protein Refseq | NP_005261 |
MIM | 165230 |
UniProt ID | P10070 |
◆ Recombinant Proteins | ||
GLI2-3595M | Recombinant Mouse GLI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLI2-6402M | Recombinant Mouse GLI2 Protein | +Inquiry |
GLI2-301505H | Recombinant Human GLI2 protein, GST-tagged | +Inquiry |
GLI2-3852H | Recombinant Human GLI2 protein, His-tagged | +Inquiry |
GLI2-133H | Recombinant Human GLI2 protein, His/sumo-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLI2 Products
Required fields are marked with *
My Review for All GLI2 Products
Required fields are marked with *
0
Inquiry Basket