Recombinant Human GLDC Protein, GST-tagged

• Cat.No.: GLDC-4950H
• Product Overview: Human GLDC partial ORF ( NP_000161.1, 922 a.a. - 1020 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes; see MIM 238310, MIM 238330, and MIM 238331.[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLDC glycine dehydrogenase (decarboxylating) [ Homo sapiens ]
• Official Symbol: GLDC
• Synonyms: GLDC; glycine dehydrogenase (decarboxylating); glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase [decarboxylating], mitochondrial; GCSP; glycine cleavage system protein P; glycine decarboxylase; NKH; glycine decarboxylase P-protein; glycine cleavage system P protein; GCE; HYGN1; MGC138198; MGC138200
• Gene ID: 2731
• mRNA Refseq: NM_000170
• Protein Refseq: NP_000161
• MIM: 238300
• UniProt ID: P23378