Recombinant Human GKN1 Protein, GST-tagged

Cat.No. : GKN1-4942H
Product Overview : Human GKN1 full-length ORF ( AAH59778, 21 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq
Molecular Mass : 43.89 kDa
AA Sequence : NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GKN1 gastrokine 1 [ Homo sapiens ]
Official Symbol GKN1
Synonyms GKN1; gastrokine 1; gastrokine-1; AMP18; BRICD1; CA11; AMP-18; BRICHOS domain containing 1; 18 kDa antrum mucosa protein; FOV; foveolin; MGC70354;
Gene ID 56287
mRNA Refseq NM_019617
Protein Refseq NP_062563
MIM 606402
UniProt ID Q9NS71

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GKN1 Products

Required fields are marked with *

My Review for All GKN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon