Recombinant Human GK

Cat.No. : GK-29028TH
Product Overview : Recombinant fragment of Human Glycerol kinase (aa 2-94) with a N terminal proprietary tag: predicted molecular weight 35.86 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 93 amino acids
Description : The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 35.860kDa inclusive of tags
Tissue specificity : Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
Sequence Similarities : Belongs to the FGGY kinase family.
Gene Name GK glycerol kinase [ Homo sapiens ]
Official Symbol GK
Synonyms GK; glycerol kinase; GK1; GKD;
Gene ID 2710
mRNA Refseq NM_000167
Protein Refseq NP_000158
MIM 300474
Uniprot ID P32189
Chromosome Location Xp21.3
Pathway Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function ATP binding; glycerol kinase activity; glycerol kinase activity; nucleotide binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GK Products

Required fields are marked with *

My Review for All GK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon