Recombinant Human GK
Cat.No. : | GK-29028TH |
Product Overview : | Recombinant fragment of Human Glycerol kinase (aa 2-94) with a N terminal proprietary tag: predicted molecular weight 35.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 93 amino acids |
Description : | The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 35.860kDa inclusive of tags |
Tissue specificity : | Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR |
Sequence Similarities : | Belongs to the FGGY kinase family. |
Gene Name | GK glycerol kinase [ Homo sapiens ] |
Official Symbol | GK |
Synonyms | GK; glycerol kinase; GK1; GKD; |
Gene ID | 2710 |
mRNA Refseq | NM_000167 |
Protein Refseq | NP_000158 |
MIM | 300474 |
Uniprot ID | P32189 |
Chromosome Location | Xp21.3 |
Pathway | Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; glycerol kinase activity; glycerol kinase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
GK-4936H | Recombinant Human GK Protein, GST-tagged | +Inquiry |
GK-3238H | Recombinant Human GK protein, His-tagged | +Inquiry |
GK-13284H | Recombinant Human GK, GST-tagged | +Inquiry |
RFL25393HF | Recombinant Full Length Human Herpesvirus 1 Glycoprotein K(Gk) Protein, His-Tagged | +Inquiry |
RFL19015EF | Recombinant Full Length Equine Herpesvirus 1 Glycoprotein K(Gk) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GK Products
Required fields are marked with *
My Review for All GK Products
Required fields are marked with *
0
Inquiry Basket