Recombinant Human GK

• Cat.No.: GK-29028TH
• Product Overview: Recombinant fragment of Human Glycerol kinase (aa 2-94) with a N terminal proprietary tag: predicted molecular weight 35.86 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 93 amino acids
• Description: The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 35.860kDa inclusive of tags
• Tissue specificity: Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
• Sequence Similarities: Belongs to the FGGY kinase family.

Gene Information

• Gene Name: GK glycerol kinase [ Homo sapiens ]
• Official Symbol: GK
• Synonyms: GK; glycerol kinase; GK1; GKD
• Gene ID: 2710
• mRNA Refseq: NM_000167
• Protein Refseq: NP_000158
• MIM: 300474
• Uniprot ID: P32189
• Chromosome Location: Xp21.3
• Pathway: Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: ATP binding; glycerol kinase activity; glycerol kinase activity; nucleotide binding; transferase activity