Recombinant Human GJD2 Protein, GST-tagged

• Cat.No.: GJD2-2146H
• Product Overview: Human CX36 partial ORF ( NP_065711.1, 99 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion. [provided by RefSeq, Oct 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GJD2 gap junction protein, delta 2, 36kDa [ Homo sapiens ]
• Official Symbol: GJD2
• Synonyms: GJD2; gap junction protein, delta 2, 36kDa; gap junction protein, alpha 9, 36kDa , GJA9; gap junction delta-2 protein; connexin 36; CX36; connexin-36; gap junction alpha-9 protein; GJA9; MGC138315; MGC138319
• Gene ID: 57369
• mRNA Refseq: NM_020660
• Protein Refseq: NP_065711
• MIM: 607058
• UniProt ID: Q9UKL4