Recombinant Human GJA5 protein, GST-tagged

• Cat.No.: GJA5-375H
• Product Overview: Recombinant Human GJA5 protein(233-341 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 233-341 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GJA5 gap junction protein, alpha 5, 40kDa [ Homo sapiens ]
• Official Symbol: GJA5
• Synonyms: GJA5; gap junction protein, alpha 5, 40kDa; gap junction protein, alpha 5, 40kD (connexin 40) , gap junction protein, alpha 5, 40kDa (connexin 40); gap junction alpha-5 protein; connexin 40; CX40; connexin-40; ATFB11; MGC11185
• Gene ID: 2702
• mRNA Refseq: NM_005266
• Protein Refseq: NP_005257
• MIM: 121013
• UniProt ID: P36382