Recombinant Human GJA4 Protein, GST-tagged

• Cat.No.: GJA4-4922H
• Product Overview: Human GJA4 full-length ORF ( NP_002051.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 63.8 kDa
• AA Sequence: MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ]
• Official Symbol: GJA4
• Synonyms: GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37), gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; connexin-37
• Gene ID: 2701
• mRNA Refseq: NM_002060
• Protein Refseq: NP_002051
• MIM: 121012
• UniProt ID: P35212