Recombinant Human GINS3 Protein, GST-tagged

• Cat.No.: GINS3-4245H
• Product Overview: Human FLJ13912 full-length ORF ( AAH05879, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
• Molecular Mass: 49.28 kDa
• AA Sequence: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GINS3 GINS complex subunit 3 (Psf3 homolog) [ Homo sapiens ]
• Official Symbol: GINS3
• Synonyms: GINS3; GINS complex subunit 3 (Psf3 homolog); DNA replication complex GINS protein PSF3; FLJ13912; PSF3
• Gene ID: 64785
• mRNA Refseq: NM_001126129
• Protein Refseq: NP_001119601
• MIM: 610610
• UniProt ID: Q9BRX5