Recombinant Human GIN1 Protein, GST-tagged

• Cat.No.: GIN1-4907H
• Product Overview: Human GIN1 full-length ORF ( AAH15325.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GIN1 (Gypsy Retrotransposon Integrase 1) is a Protein Coding gene. Diseases associated with GIN1 include Parametritis and Osmotic Diarrhea. GO annotations related to this gene include nucleic acid binding.
• Molecular Mass: 52.1 kDa
• AA Sequence: MVRSGKNGDLHLKQIAYYKRTCEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEFIQQKVFISCKVQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GIN1 gypsy retrotransposon integrase 1 [ Homo sapiens ]
• Official Symbol: GIN1
• Synonyms: GIN1; gypsy retrotransposon integrase 1; ZH2C2, zinc finger, H2C2 domain containing; gypsy retrotransposon integrase-like protein 1; FLJ20125; GIN 1; gypsy integrase 1; TGIN1; Ty3/Gypsy integrase 1; zinc finger, H2C2 domain containing; zinc finger H2C2 domain-containing protein; GIN-1; ZH2C2
• Gene ID: 54826
• mRNA Refseq: NM_017676
• Protein Refseq: NP_060146
• UniProt ID: Q9NXP7