Recombinant Human GHRHR Protein, GST-tagged

• Cat.No.: GHRHR-4891H
• Product Overview: Human GHRHR partial ORF ( NP_000814, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKII
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GHRHR growth hormone releasing hormone receptor [ Homo sapiens ]
• Official Symbol: GHRHR
• Synonyms: GHRHR; growth hormone releasing hormone receptor; growth hormone-releasing hormone receptor; GRF receptor; GHRH receptor; GRFR; GHRFR; IGHD1B
• Gene ID: 2692
• mRNA Refseq: NM_000823
• Protein Refseq: NP_000814
• MIM: 139191
• UniProt ID: Q02643