Recombinant Full Length Pig Growth Hormone-Releasing Hormone Receptor(Ghrhr) Protein, His-Tagged
Cat.No. : | RFL17658SF |
Product Overview : | Recombinant Full Length Pig Growth hormone-releasing hormone receptor(GHRHR) Protein (P34999) (23-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-423) |
Form : | Lyophilized powder |
AA Sequence : | HVHPECDFITQLREDERTCLQAADRMANSSSGCPRTWDGLLCWPTAGPGEWVTLPCPAFF SHFSSEPGALKRDCTTTGWSEPFPPYPEACPVPLELLTDEKSYFSTVRIVYTTGHSVSAV ALFVAIAILVALRRLHCPRNYIHSQLFATFILKAGAVFLKDAALFHSENTDHCSFSTVLC KVSVATSHFATMTNFSWLLAEAVYLTCLLASTSPSTRRAFWWLVLAGWGLPLLFTGTWVG CKLAFEDVACWDLDDSSPYWWIIKGPIVLSVGVNFGLFLNIIRILLRKLEPAQGSLHTQP QYWRLSKSTLLLIPLFGIHYVIFNFLPDSAGLGIRLPLELGLGSFQGFIVAILYCFLNQE VRTEISRRWHGHDPELLPAWRTHAKWAKPSRSRAKVLTTVC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GHRHR |
Synonyms | GHRHR; Growth hormone-releasing hormone receptor; GHRH receptor; Growth hormone-releasing factor receptor; GRF receptor; GRFR |
UniProt ID | P34999 |
◆ Recombinant Proteins | ||
RFL29079MF | Recombinant Full Length Mouse Growth Hormone-Releasing Hormone Receptor(Ghrhr) Protein, His-Tagged | +Inquiry |
GHRHR-29025TH | Recombinant Human GHRHR | +Inquiry |
GHRHR-2530R | Recombinant Rat GHRHR Protein | +Inquiry |
GHRHR-7849H | Recombinant Human GHRHR protein, His & GST-tagged | +Inquiry |
GHRHR-3551M | Recombinant Mouse GHRHR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHRHR Products
Required fields are marked with *
My Review for All GHRHR Products
Required fields are marked with *
0
Inquiry Basket