Recombinant Human GFOD2 Protein, GST-tagged
Cat.No. : | GFOD2-4857H |
Product Overview : | Human GFOD2 full-length ORF ( AAH00757.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1. |
Molecular Mass : | 57.3 kDa |
AA Sequence : | MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens ] |
Official Symbol | GFOD2 |
Synonyms | GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316; |
Gene ID | 81577 |
mRNA Refseq | NM_001243650 |
Protein Refseq | NP_001230579 |
UniProt ID | Q3B7J2 |
◆ Recombinant Proteins | ||
GFOD2-13232H | Recombinant Human GFOD2, His-tagged | +Inquiry |
GFOD2-4857H | Recombinant Human GFOD2 Protein, GST-tagged | +Inquiry |
Gfod2-1016M | Recombinant Mouse Gfod2 Protein, His-tagged | +Inquiry |
GFOD2-1656R | Recombinant Rhesus Macaque GFOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFOD2-5508H | Recombinant Human GFOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD2-697HCL | Recombinant Human GFOD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFOD2 Products
Required fields are marked with *
My Review for All GFOD2 Products
Required fields are marked with *
0
Inquiry Basket