Recombinant Human GFOD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GFOD1-1816H
• Product Overview: GFOD1 MS Standard C13 and N15-labeled recombinant protein (NP_061861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1) is a Protein Coding gene. Diseases associated with GFOD1 include Attention Deficit-Hyperactivity Disorder. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD2.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 43 kDa
• AA Sequence: MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: GFOD1
• Synonyms: GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1
• Gene ID: 54438
• mRNA Refseq: NM_018988
• Protein Refseq: NP_061861
• UniProt ID: Q9NXC2