Recombinant Human GFOD1, His-tagged

• Cat.No.: GFOD1-91H
• Product Overview: Recombinant Human Glucose-Fructose Oxidoreductase Domain-Containing Protein 1/GFOD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Cys390) of Human GFOD1 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-390 a.a.
• Description: Glucose-Fructose Oxidoreductase Domain-Containing Protein 1 (GFOD1) is a member of the Gfo/Idh/MocA family. GFOD1 is a secreted protein and localizes to the extracellular region. GFOD1 has three spliced transcript isoforms. GFOD1 molecular has the nucleotide binding activity and oxidoreductase activity.
• AA Sequence: KDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGI GKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVH GGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQIT SDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQD ATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCV VDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ]
• Official Symbol: GFOD1
• Synonyms: GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1
• Gene ID: 54438
• mRNA Refseq: NM_001242628
• Protein Refseq: NP_001229557
• UniProt ID: Q9NXC2
• Chromosome Location: 6pter-p22.1
• Function: nucleotide binding; oxidoreductase activity