Recombinant Human GFOD1 Protein, GST-Tagged
Cat.No. : | GFOD1-0102H |
Product Overview : | Human C6orf114 full-length ORF (NP_149060.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1) is a Protein Coding gene. Diseases associated with GFOD1 include Attention Deficit-Hyperactivity Disorder. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD2. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | MGDSRRDVLHEPAIALLSSPQTQSRLQIDAFIARRCWGSQWDITGYIHQQDFPTAVFIGFSNEFNICIPHPFTEWLQCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWSET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ] |
Official Symbol | GFOD1 |
Synonyms | GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1; |
Gene ID | 54438 |
mRNA Refseq | NM_001242628 |
Protein Refseq | NP_001229557 |
UniProt ID | Q9NXC2 |
◆ Recombinant Proteins | ||
GFOD1-3258HF | Recombinant Full Length Human GFOD1 Protein, GST-tagged | +Inquiry |
Gfod1-3194M | Recombinant Mouse Gfod1 Protein, Myc/DDK-tagged | +Inquiry |
GFOD1-1857H | Recombinant Human GFOD1 Protein, His-tagged | +Inquiry |
GFOD1-001H | Recombinant Human GFOD1 Protein, Myc/DDK-tagged | +Inquiry |
GFOD1-0102H | Recombinant Human GFOD1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD1-696HCL | Recombinant Human GFOD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFOD1 Products
Required fields are marked with *
My Review for All GFOD1 Products
Required fields are marked with *
0
Inquiry Basket