Recombinant Human GFOD1 Protein, GST-Tagged

• Cat.No.: GFOD1-0102H
• Product Overview: Human C6orf114 full-length ORF (NP_149060.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1) is a Protein Coding gene. Diseases associated with GFOD1 include Attention Deficit-Hyperactivity Disorder. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.4 kDa
• AA Sequence: MGDSRRDVLHEPAIALLSSPQTQSRLQIDAFIARRCWGSQWDITGYIHQQDFPTAVFIGFSNEFNICIPHPFTEWLQCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWSET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ]
• Official Symbol: GFOD1
• Synonyms: GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1
• Gene ID: 54438
• mRNA Refseq: NM_001242628
• Protein Refseq: NP_001229557
• UniProt ID: Q9NXC2