Recombinant Human GEMIN7 Protein, GST-tagged

• Cat.No.: GEMIN7-4843H
• Product Overview: Human GEMIN7 full-length ORF ( AAH07793, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
• Molecular Mass: 40.15 kDa
• AA Sequence: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GEMIN7 gem (nuclear organelle) associated protein 7 [ Homo sapiens ]
• Official Symbol: GEMIN7
• Synonyms: GEMIN7; gem (nuclear organelle) associated protein 7; gem-associated protein 7; FLJ13956; gemin 7; gemin-7; SIP3
• Gene ID: 79760
• mRNA Refseq: NM_001007269
• Protein Refseq: NP_001007270
• MIM: 607419
• UniProt ID: Q9H840