Recombinant Human GDI1 protein, His-tagged

• Cat.No.: GDI1-2448H
• Product Overview: Recombinant Human GDI1 protein(1-209 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-209 aa
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 0.3M Arginine.
• Molecular Mass: The protein has a calculated MW of 28 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI

Gene Information

• Gene Name: GDI1 GDP dissociation inhibitor 1 [ Homo sapiens ]
• Official Symbol: GDI1
• Synonyms: GDI1; GDP dissociation inhibitor 1; GDIL, MRX41, MRX48; rab GDP dissociation inhibitor alpha; FLJ41411; mental retardation; X linked 41; X linked 48; OPHN2; rab GDP dissociation inhibitor; alpha; RABGDIA; XAP 4; GDI-1; protein XAP-4; rab GDI alpha; oligophrenin-2; mental retardation, X-linked 48; rab GDP-dissociation inhibitor, alpha; guanosine diphosphate dissociation inhibitor 1; 1A; GDIL; MRX41; MRX48; XAP-4; RABGD1A
• Gene ID: 2664
• mRNA Refseq: NM_001493
• Protein Refseq: NP_001484
• MIM: 300104
• UniProt ID: P31150