Recombinant Human GDF11 protein, His-SUMO-tagged
Cat.No. : | GDF11-2952H |
Product Overview : | Recombinant Human GDF11 protein(O95390)(299-407aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 299-407aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.5 kDa |
AA Sequence : | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GDF11 growth differentiation factor 11 [ Homo sapiens ] |
Official Symbol | GDF11 |
Synonyms | GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11; |
Gene ID | 10220 |
mRNA Refseq | NM_005811 |
Protein Refseq | NP_005802 |
MIM | 603936 |
UniProt ID | O95390 |
◆ Recombinant Proteins | ||
GDF11-6284M | Recombinant Mouse GDF11 Protein | +Inquiry |
GDF11-155H | Recombinant Human GDF11 Protein | +Inquiry |
GDF11-12223Z | Recombinant Zebrafish GDF11 | +Inquiry |
GDF11-01H | Recombinant Human GDF11 protein | +Inquiry |
GDF11-105H | Active Recombinant Human/Mouse/Rat GDF11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF11 Products
Required fields are marked with *
My Review for All GDF11 Products
Required fields are marked with *
0
Inquiry Basket