Recombinant Human GDF10 Protein (111 aa)

• Cat.No.: GDF10-436G
• Product Overview: Recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 111 amino acids each. rhBMP-3B has a molecular mass of 25.1 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 111
• Description: Bone Morphogenetic Protein-3B (BMP-3B), also known as Growth/Differentiation Factor 10 (GDF-10), is a cytokine belonging to the Transforming Growth Factor β (TGF-β) superfamily. BMP-3B contains the cystine knot motif shared by other TGF-β family members. BMP-3B was originally identified by PCR based on the BMP-3 sequence, and shares 83% identity with BMP-3. BMP-3B and BMP-2 act as mutual antagonists, as they compete for the availability of signaling protein Smad4. In vivo, BMP-3B is highly expressed in brain, lungs, and bone tissues. The functions of BMP-3B include acting as a dorsaling factor in head development, inhibition of adipogenesis in adipocytes, and induction of bone formation. BMP-3B is down-regulated in lung cancer patient samples, indicating its potential antitumor activity.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Molecular Mass: 25.1 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhBMP-3B remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 4mM HCl.
• Reconstitution: Reconstituted in 4mM HCl at 100 μg/mL.

Gene Information

• Gene Name: GDF10 growth differentiation factor 10 [ Homo sapiens ]
• Official Symbol: GDF10
• Synonyms: GDF10; growth differentiation factor 10; bone morphogenetic protein 3B; BMP 3b; BIP; GDF-10; bone-inducing protein; BMP3B; BMP-3b
• Gene ID: 2662
• mRNA Refseq: NM_004962
• Protein Refseq: NP_004953
• MIM: 601361
• UniProt ID: P55107