Recombinant Human GCH1
Cat.No. : | GCH1-28283TH |
Product Overview : | Recombinant fragment of Human GTP cyclohydrolase 1 with N-terminal proprietary tag.Mol Wt 35.42 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. |
Molecular Weight : | 35.420kDa inclusive of tags |
Tissue specificity : | In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV |
Sequence Similarities : | Belongs to the GTP cyclohydrolase I family. |
Gene Name | GCH1 GTP cyclohydrolase 1 [ Homo sapiens ] |
Official Symbol | GCH1 |
Synonyms | GCH1; GTP cyclohydrolase 1; dystonia 14 , DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1; |
Gene ID | 2643 |
mRNA Refseq | NM_000161 |
Protein Refseq | NP_000152 |
MIM | 600225 |
Uniprot ID | P30793 |
Chromosome Location | 14q22.1-q22.2 |
Pathway | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; |
Function | GTP binding; GTP cyclohydrolase I activity; NOT GTP cyclohydrolase I activity; GTP-dependent protein binding; calcium ion binding; |
◆ Recombinant Proteins | ||
GCH1-5170HF | Recombinant Full Length Human GCH1 Protein, GST-tagged | +Inquiry |
GCH1-28283TH | Recombinant Human GCH1 | +Inquiry |
GCH1-7210Z | Recombinant Zebrafish GCH1 | +Inquiry |
GCH1-2489R | Recombinant Rat GCH1 Protein | +Inquiry |
GCH1-2145R | Recombinant Rat GCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCH1-5988HCL | Recombinant Human GCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCH1 Products
Required fields are marked with *
My Review for All GCH1 Products
Required fields are marked with *
0
Inquiry Basket