Recombinant Human GCG protein, His-GST-tagged
Cat.No. : | GCG-2950H |
Product Overview : | Recombinant Human GCG protein(P01275)(53-89aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 53-89aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.4 kDa |
AA Sequence : | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GCG glucagon [ Homo sapiens ] |
Official Symbol | GCG |
Synonyms | GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; |
Gene ID | 2641 |
mRNA Refseq | NM_002054 |
Protein Refseq | NP_002045 |
MIM | 138030 |
UniProt ID | P01275 |
◆ Recombinant Proteins | ||
GCG-01H | Recombinant Human GCG Protein, His-Tagged | +Inquiry |
GCG-30529TH | Recombinant Human GCG | +Inquiry |
GCG-1261H | Recombinant Human GCG Protein, MYC/DDK-tagged | +Inquiry |
GCG-2949H | Recombinant Human GCG protein, GST-tagged | +Inquiry |
GCG-4793H | Recombinant Human GCG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCG-5990HCL | Recombinant Human GCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCG Products
Required fields are marked with *
My Review for All GCG Products
Required fields are marked with *
0
Inquiry Basket