Recombinant Human GCG

• Cat.No.: GCG-30529TH
• Product Overview: Recombinant fragment human Oxyntomodulin is a single, non-glycosylated polypeptide chain containing 37 amino acids and having a molecular mass of4kDa.

Specification

• Description: The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
• Source: E. coli
• Form: Lyophilised:Reconstitute in 20mM acetic acid.
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: None
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
• Tag: Non

Gene Information

• Gene Name: GCG glucagon [ Homo sapiens ]
• Official Symbol: GCG
• Synonyms: GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP
• Gene ID: 2641
• mRNA Refseq: NM_002054
• Protein Refseq: NP_002045
• MIM: 138030
• Uniprot ID: P01275
• Chromosome Location: 2q36-q37
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem
• Function: glucagon receptor binding; hormone activity; receptor binding