Recombinant Human GBAS Protein, GST-tagged

• Cat.No.: GBAS-4770H
• Product Overview: Human GBAS full-length ORF (1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport. [provided by RefSeq
• Molecular Mass: 55.5 kDa
• AA Sequence: MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFKRCCQRFTKINTTLVLWWGLGTRGMASRTKLEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GBAS glioblastoma amplified sequence [ Homo sapiens ]
• Official Symbol: GBAS
• Synonyms: GBAS; glioblastoma amplified sequence; protein NipSnap homolog 2; NIPSNAP2; 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2
• Gene ID: 2631
• mRNA Refseq: NM_001202469
• Protein Refseq: NP_001189398
• MIM: 603004
• UniProt ID: O75323