Recombinant Human GATS Protein, GST-tagged

• Cat.No.: GATS-4763H
• Product Overview: Human GATS full-length ORF ( NP_849153.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GATS (GATS, Stromal Antigen 3 Opposite Strand) is a Protein Coding gene. Among its related pathways are Gastric Cancer Network 1. An important paralog of this gene is CASTOR2.
• Molecular Mass: 44.2 kDa
• AA Sequence: MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLKRDLPFVTHTLSSEFTILWSVARL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GATS GATS, stromal antigen 3 opposite strand [ Homo sapiens (human) ]
• Official Symbol: GATS
• Synonyms: GATS; GATS, stromal antigen 3 opposite strand; STAG3OS; putative protein GATS; STAG3 opposite strand transcript protein; opposite strand transcription unit to STAG3; stromal antigen 3 opposite strand
• Gene ID: 352954
• mRNA Refseq: NM_178831
• Protein Refseq: NP_849153
• UniProt ID: Q8NAP1