Recombinant Human GATS Protein, GST-tagged
Cat.No. : | GATS-4763H |
Product Overview : | Human GATS full-length ORF ( NP_849153.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GATS (GATS, Stromal Antigen 3 Opposite Strand) is a Protein Coding gene. Among its related pathways are Gastric Cancer Network 1. An important paralog of this gene is CASTOR2. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLKRDLPFVTHTLSSEFTILWSVARL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GATS GATS, stromal antigen 3 opposite strand [ Homo sapiens (human) ] |
Official Symbol | GATS |
Synonyms | GATS; GATS, stromal antigen 3 opposite strand; STAG3OS; putative protein GATS; STAG3 opposite strand transcript protein; opposite strand transcription unit to STAG3; stromal antigen 3 opposite strand |
Gene ID | 352954 |
mRNA Refseq | NM_178831 |
Protein Refseq | NP_849153 |
UniProt ID | Q8NAP1 |
◆ Recombinant Proteins | ||
GATS-5484HF | Recombinant Full Length Human GATS Protein, GST-tagged | +Inquiry |
GATS-13172H | Recombinant Human GATS, His-tagged | +Inquiry |
GATS-4763H | Recombinant Human GATS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATS-690HCL | Recombinant Human GATS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATS Products
Required fields are marked with *
My Review for All GATS Products
Required fields are marked with *
0
Inquiry Basket