Recombinant Human GATM
Cat.No. : | GATM-28986TH |
Product Overview : | Recombinant fragment of Human GATM with an N-terminal proprietary tag; Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in brain, heart, kidney, liver, lung, salivary gland and skeletal muscle tissue, with the highest expression in kidney. Biallelically expressed in placenta and fetal tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQ AATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIV GRAENACVPPFTIEVKANTY |
Sequence Similarities : | Belongs to the amidinotransferase family. |
Gene Name | GATM glycine amidinotransferase (L-arginine:glycine amidinotransferase) [ Homo sapiens ] |
Official Symbol | GATM |
Synonyms | GATM; glycine amidinotransferase (L-arginine:glycine amidinotransferase); glycine amidinotransferase, mitochondrial; AGAT; |
Gene ID | 2628 |
mRNA Refseq | NM_001482 |
Protein Refseq | NP_001473 |
MIM | 602360 |
Uniprot ID | P50440 |
Chromosome Location | 15q15.1 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; |
Function | glycine amidinotransferase activity; glycine amidinotransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
GATM-6310C | Recombinant Chicken GATM | +Inquiry |
GATM-2141R | Recombinant Rat GATM Protein, His (Fc)-Avi-tagged | +Inquiry |
GATM-4761H | Recombinant Human GATM Protein, GST-tagged | +Inquiry |
GATM-538C | Recombinant Cynomolgus GATM Protein, His-tagged | +Inquiry |
GATM-3489M | Recombinant Mouse GATM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATM-6005HCL | Recombinant Human GATM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATM Products
Required fields are marked with *
My Review for All GATM Products
Required fields are marked with *
0
Inquiry Basket