Recombinant Human GATA3 protein, His-tagged

Cat.No. : GATA3-2940H
Product Overview : Recombinant Human GATA3(1-262aa) fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-262aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence : MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRY PPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHL FTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY VPEYSSGLFPPSSLLGGSPTGFGCKSRPKA
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name GATA3 GATA binding protein 3 [ Homo sapiens ]
Official Symbol GATA3
Synonyms GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR; GATA-binding factor 3; HDRS; MGC2346; MGC5199; MGC5445;
Gene ID 2625
mRNA Refseq NM_001002295
Protein Refseq NP_001002295
MIM 131320
UniProt ID P23771
Chromosome Location 10p15
Pathway Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem;
Function DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specific DNA binding; core promoter sequence-specific DNA binding; metal ion binding; nucleic acid binding transcription factor activity; nucleic acid binding transcription factor activity; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GATA3 Products

Required fields are marked with *

My Review for All GATA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon