Recombinant Human GATA1, His-tagged
Cat.No. : | GATA1-28476TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 70-413 of Human GATA1 with N terminal His tag; 344 amino acids, 52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 70-413 a.a. |
Description : | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTV CPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLT LGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAY SSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQT TTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDG IQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHL MPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
Gene Name | GATA1 GATA binding protein 1 (globin transcription factor 1) [ Homo sapiens ] |
Official Symbol | GATA1 |
Synonyms | GATA1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1 (globin transcription factor 1) , GF1; erythroid transcription factor; ERYF1; GATA 1; NFE1; |
Gene ID | 2623 |
mRNA Refseq | NM_002049 |
Protein Refseq | NP_002040 |
MIM | 305371 |
Uniprot ID | P15976 |
Chromosome Location | Xp11.23 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; |
Function | C2H2 zinc finger domain binding; DNA bending activity; DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
GATA1-3481M | Recombinant Mouse GATA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA1-2137R | Recombinant Rat GATA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gata1-474M | Recombinant Mouse Gata1 Protein, His-tagged | +Inquiry |
GATA1-2481R | Recombinant Rat GATA1 Protein | +Inquiry |
GATA1-6938HF | Recombinant Full Length Human GATA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA1-689HCL | Recombinant Human GATA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATA1 Products
Required fields are marked with *
My Review for All GATA1 Products
Required fields are marked with *
0
Inquiry Basket