Recombinant Human GAS2L2 Protein, GST-tagged

• Cat.No.: GAS2L2-4737H
• Product Overview: Human GAS2L2 partial ORF ( NP_644814, 665 a.a. - 776 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene appears to crosslink microtubules and microfilaments and may be part of the cytoskeleton. This gene is mainly expressed in skeletal muscle. [provided by RefSeq, Jul 2011]
• Molecular Mass: 38.06 kDa
• AA Sequence: LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAS2L2 growth arrest specific 2 like 2 [ Homo sapiens (human) ]
• Official Symbol: GAS2L2
• Synonyms: GAS2L2; growth arrest specific 2 like 2; GAR17; GAS2-like protein 2; GAS2-related protein on chromosome 17
• Gene ID: 246176
• mRNA Refseq: NM_139285
• Protein Refseq: NP_644814
• MIM: 611398
• UniProt ID: Q8NHY3