Recombinant Human GARS1 protein(61-130 aa), C-His-tagged

• Cat.No.: GARS1-2758H
• Product Overview: Recombinant Human GARS1 protein(P41250)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 61-130 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• AASequence: EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKR
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.