Recombinant Human GAR1 Protein, GST-tagged

Cat.No. : GAR1-5978H
Product Overview : Human NOLA1 partial ORF ( NP_127460, 60 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq
Molecular Mass : 35.75 kDa
AA Sequence : KGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAR1 GAR1 ribonucleoprotein homolog (yeast) [ Homo sapiens ]
Official Symbol GAR1
Synonyms GAR1 ribonucleoprotein homolog (yeast); 14264; Ensembl:ENSG00000109534; H/ACA ribonucleoprotein complex subunit 1;snoRNP protein GAR1;nucleolar protein family A member 1;nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs); NOLA1
Gene ID 54433
mRNA Refseq NM_018983
Protein Refseq NP_061856
MIM 606468
UniProt ID Q9NY12

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GAR1 Products

Required fields are marked with *

My Review for All GAR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon