Recombinant Human GAPDH protein, T7/His-tagged
Cat.No. : | GAPDH-231H |
Product Overview : | Recombinant human GAPDH cDNA ( 2 – 335 aa, Isoform-I ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-335 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMF QYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS APSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWR DGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKG ILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens ] |
Official Symbol | GAPDH |
Synonyms | GAPDH; glyceraldehyde-3-phosphate dehydrogenase; GAPD; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; G3PD; MGC88685; |
Gene ID | 2597 |
mRNA Refseq | NM_001256799 |
Protein Refseq | NP_001243728 |
MIM | 138400 |
UniProt ID | P04406 |
Chromosome Location | 12p13.31 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => |
Function | NAD binding; NADP binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; oxidoreductase activity; peptidyl-cysteine S-nitrosylase activity; protein b |
◆ Recombinant Proteins | ||
GAPDH-20H | Active Recombinant Human GAPDH protein (Bioactivity Validated) | +Inquiry |
GAPDH-959H | Recombinant Human GAPDH Protein, His (Fc)-Avi-tagged | +Inquiry |
Gapdh-3150M | Recombinant Mouse Gapdh Protein, Myc/DDK-tagged | +Inquiry |
GAPDH-180HF | Recombinant Full Length Human GAPDH Protein, GST-tagged | +Inquiry |
GAPDH-5133H | Recombinant Human GAPDH protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAPDH-6024HCL | Recombinant Human GAPDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAPDH Products
Required fields are marked with *
My Review for All GAPDH Products
Required fields are marked with *
0
Inquiry Basket