Recombinant Human GAPDH, GST-tagged
Cat.No. : | GAPDH-117H |
Product Overview : | Human GAPDH full-length ORF (1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 62.59 kDa |
AA Sequence : | MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPIT IFQERDPSKIKWGDAGAEYVVESTG VFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISN ASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGR GALQNIIPASTGAAKAVGKVIPE LNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG AG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | GAPDH |
Synonyms | GAPDH; G3PD; GAPD; glyceraldehyde-3-phosphate dehydrogenase; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; EC 1.2.1.12 |
Gene ID | 2597 |
mRNA Refseq | NM_002046 |
Protein Refseq | NP_002037 |
MIM | 138400 |
UniProt ID | P04406 |
Chromosome Location | 12p13 |
Pathway | Alzheimer''s disease; Biosynthesis of amino acids; Carbon metabolism |
Function | NAD binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; identical protein binding |
◆ Recombinant Proteins | ||
Gapdh-3150M | Recombinant Mouse Gapdh Protein, Myc/DDK-tagged | +Inquiry |
GAPDH-2961H | Recombinant Human GAPDH Protein (Met1-Glu335), C-His tagged | +Inquiry |
GAPDH-2132R | Recombinant Rat GAPDH Protein, His (Fc)-Avi-tagged | +Inquiry |
GAPDH-959H | Recombinant Human GAPDH Protein, His (Fc)-Avi-tagged | +Inquiry |
GAPDH-2519H | Recombinant Human GAPDH protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAPDH-6024HCL | Recombinant Human GAPDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAPDH Products
Required fields are marked with *
My Review for All GAPDH Products
Required fields are marked with *
0
Inquiry Basket