Recombinant Human GAP43

Cat.No. : GAP43-28977TH
Product Overview : Recombinant full length Human GAP43 with an N terminal proprietary tag; Predicted MWt 52.29 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 238 amino acids
Description : The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight : 52.290kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQA SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Sequence Similarities : Belongs to the neuromodulin family.Contains 1 IQ domain.
Gene Name GAP43 growth associated protein 43 [ Homo sapiens ]
Official Symbol GAP43
Synonyms GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1;
Gene ID 2596
mRNA Refseq NM_001130064
Protein Refseq NP_001123536
MIM 162060
Uniprot ID P17677
Chromosome Location 3q21-qter
Pathway N-cadherin signaling events, organism-specific biosystem;
Function calmodulin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GAP43 Products

Required fields are marked with *

My Review for All GAP43 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon