Recombinant Human GALNT3 Protein, His tagged

• Cat.No.: GALNT3-3289H
• Product Overview: Recombinant Human GALNT3 protein(Gln38-Asp633), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Gln38-Asp633
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 69 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQNDAHHHHHHHHHH

Gene Information

• Gene Name: GALNT3 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [ Homo sapiens ]
• Official Symbol: GALNT3
• Synonyms: GALNT3; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3); polypeptide N-acetylgalactosaminyltransferase 3; GalNAc T3; HFTC; HHS; pp-GaNTase 3; GalNAc transferase 3; polypeptide GalNAc transferase 3; polypeptide GalNAc-transferase T3; protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T3; MGC61909; DKFZp686C10199
• Gene ID: 2591
• mRNA Refseq: NM_004482
• Protein Refseq: NP_004473
• MIM: 601756
• UniProt ID: Q14435