Recombinant Human GALNT3 protein, His-tagged
Cat.No. : | GALNT3-3444H |
Product Overview : | Recombinant Human GALNT3 protein(1-176 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 1-176 aa |
AA Sequence : | MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GALNT3 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [ Homo sapiens ] |
Official Symbol | GALNT3 |
Synonyms | GALNT3; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3); polypeptide N-acetylgalactosaminyltransferase 3; GalNAc T3; HFTC; HHS; pp-GaNTase 3; GalNAc transferase 3; polypeptide GalNAc transferase 3; polypeptide GalNAc-transferase T3; protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T3; MGC61909; DKFZp686C10199; |
Gene ID | 2591 |
mRNA Refseq | NM_004482 |
Protein Refseq | NP_004473 |
MIM | 601756 |
UniProt ID | Q14435 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GALNT3 Products
Required fields are marked with *
My Review for All GALNT3 Products
Required fields are marked with *
0
Inquiry Basket