Recombinant Human GALNT2
Cat.No. : | GALNT2-27303TH |
Product Overview : | Recombinant fragment of Human GALNT2 with an N terminal proprietary tag; Predicted MW 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | This gene encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ |
Sequence Similarities : | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain. |
Gene Name | GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) [ Homo sapiens ] |
Official Symbol | GALNT2 |
Synonyms | GALNT2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2); polypeptide N-acetylgalactosaminyltransferase 2; GalNAc T2; |
Gene ID | 2590 |
mRNA Refseq | NM_004481 |
Protein Refseq | NP_004472 |
MIM | 602274 |
Uniprot ID | Q10471 |
Chromosome Location | 1q41-q42 |
Pathway | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
Function | manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
GALNT2-4699H | Recombinant Human GALNT2 Protein, GST-tagged | +Inquiry |
GALNT2-27303TH | Recombinant Human GALNT2 | +Inquiry |
GALNT2-3005H | Recombinant Human GALNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT2-6185M | Recombinant Mouse GALNT2 Protein | +Inquiry |
GALNT2-229H | Recombinant Human GALNT2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALNT2 Products
Required fields are marked with *
My Review for All GALNT2 Products
Required fields are marked with *
0
Inquiry Basket