Recombinant Human GALNT1 Protein (AA 47-559), N-6×His/GFP tagged

• Cat.No.: GALNT1-28H
• Product Overview: Recombinant Human GALNT1 Protein (AA 47-559) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&GFP
• ProteinLength: AA 47-559
• Description: This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature.
• Molecular Mass: ~92 kDa
• AA Sequence: VLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDIDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF
• Purity: >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens (human) ]
• Official Symbol: GALNT1
• Synonyms: GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1; pp-GaNTase 1; GalNAc transferase 1; polypeptide GalNAc transferase 1; protein-UDP acetylgalactosaminyltransferase 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1; GALNAC-T1
• Gene ID: 2589
• mRNA Refseq: NM_020474
• Protein Refseq: NP_065207
• MIM: 602273
• UniProt ID: Q10472