Recombinant Human GALNT1

• Cat.No.: GALNT1-27304TH
• Product Overview: Recombinant fragment of Human GALNT1 with N terminal proprietary tag. Predicted MW 34.65 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 82 amino acids
• Description: This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature.
• Molecular Weight: 34.650kDa inclusive of tags
• Tissue specificity: Widely expressed. Expressed in all tissues tested.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
• Sequence Similarities: Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain.

Gene Information

• Gene Name: GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ]
• Official Symbol: GALNT1
• Synonyms: GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1
• Gene ID: 2589
• mRNA Refseq: NM_020474
• Protein Refseq: NP_065207
• MIM: 602273
• Uniprot ID: Q10472
• Chromosome Location: 18q12.1
• Pathway: Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem
• Function: manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups