Recombinant Human GALNS, GST-tagged

Cat.No. : GALNS-101H
Product Overview : Recombinant Human GALNS (423 a.a. - 522 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder.
Molecular Mass : 36.74 kDa
AA Sequence : NVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWA PPGCEKLGKCLTPPESIPKKCLWSH
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GALNS galactosamine (N-acetyl)-6-sulfate sulfatase [ Homo sapiens (human) ]
Official Symbol GALNS
Synonyms GALNS; GAS; MPS4A; GalN6S; GALNAC6S; galactosamine (N-acetyl)-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfatase; chondroitinase; galNAc6S sulfatase; chondroitinsulfatase; galactose-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfate sulfatase; NP_000503.1; EC 3.1.6.4
Gene ID 2588
mRNA Refseq NM_000512
Protein Refseq NP_000503
MIM 612222
UniProt ID P34059
Chromosome Location 16q24.3
Pathway Chondroitin sulfate degradation; Keratan sulfate degradation; Lysosome
Function N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-6-sulfatase activity; metal ion binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GALNS Products

Required fields are marked with *

My Review for All GALNS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon