Recombinant Human GAGE6 Protein, GST-tagged

Cat.No. : GAGE6-4667H
Product Overview : Human GAGE6 full-length ORF ( AAI48436.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 39.27 kDa
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAGE6 G antigen 6 [ Homo sapiens (human) ]
Official Symbol GAGE6
Synonyms GAGE6; G antigen 6; CT4.6; G antigen 6; GAGE-6; cancer/testis antigen 4.6; cancer/testis antigen family 4, member 6
Gene ID 2578
mRNA Refseq NM_001476
Protein Refseq NP_001467
MIM 300599
UniProt ID Q13070

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GAGE6 Products

Required fields are marked with *

My Review for All GAGE6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon