Recombinant Human GAGE5 Protein, GST-tagged

• Cat.No.: GAGE5-4666H
• Product Overview: Human GAGE5 partial ORF ( NP_001466.1, 28 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: RPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAGE5 G antigen 5 [ Homo sapiens ]
• Official Symbol: GAGE5
• Synonyms: GAGE5; G antigen 5; cancer/testis antigen family 4; member 5; CT4.5; GAGE-5; cancer/testis antigen 4.5; cancer/testis antigen family 4, member 5
• Gene ID: 2577
• mRNA Refseq: NM_001475
• Protein Refseq: NP_001466
• MIM: 300598
• UniProt ID: Q13069