Recombinant Human GAGE12B Protein, GST-tagged

• Cat.No.: GAGE12B-4665H
• Product Overview: Human GAGE12B full-length ORF (ADR82812.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GAGE12B (G Antigen 12B) is a Protein Coding gene.
• Molecular Mass: 39.3 kDa
• AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAGE12B G antigen 12B [ Homo sapiens (human) ]
• Official Symbol: GAGE12B
• Synonyms: GAGE12B; G antigen 12B; GAGE-12B; G antigen 12B/C/D/E
• Gene ID: 729428
• mRNA Refseq: NM_001127345
• Protein Refseq: NP_001120817
• UniProt ID: A1L429