Recombinant Human GADL1 Protein, GST-tagged
Cat.No. : | GADL1-4662H |
Product Overview : | Human GADL1 full-length ORF (BAC87546.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GADL1 (Glutamate Decarboxylase Like 1) is a Protein Coding gene. Diseases associated with GADL1 include Gadl1-Related Altered Drug Metabolism. Among its related pathways are Amino acid synthesis and interconversion (transamination) and Viral mRNA Translation. GO annotations related to this gene include pyridoxal phosphate binding and sulfinoalanine decarboxylase activity. An important paralog of this gene is CSAD. |
Molecular Mass : | 64.9 kDa |
AA Sequence : | MYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLVDEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GADL1 glutamate decarboxylase-like 1 [ Homo sapiens ] |
Official Symbol | GADL1 |
Synonyms | GADL1; glutamate decarboxylase-like 1; Glutamate Decarboxylase Like 1; Glutamate Decarboxylase-Like Protein 1; Cysteine Sulfinic Acid Decarboxylase; Aspartate 1-Decarboxylase; EC 4.1.1.29; HuCSADC; CSADC; HuADC; ADC; Acidic Amino Acid Decarboxylase GADL1; Glutamate Decarboxylase-Like 1; EC 4.1.1.15; EC 4.1.1.11; EC 4.1.1 |
Gene ID | 339896 |
mRNA Refseq | NM_207359 |
Protein Refseq | NP_997242 |
MIM | 615601 |
UniProt ID | Q6ZQY3 |
◆ Recombinant Proteins | ||
GADL1-5210HF | Recombinant Full Length Human GADL1 Protein, GST-tagged | +Inquiry |
GADL1-4662H | Recombinant Human GADL1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GADL1 Products
Required fields are marked with *
My Review for All GADL1 Products
Required fields are marked with *
0
Inquiry Basket