Recombinant Human GABRB1 Protein, GST-tagged

• Cat.No.: GABRB1-4645H
• Product Overview: Human GABRB1 partial ORF ( NP_000803, 28 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia. [provided by RefSeq
• Molecular Mass: 37.73 kDa
• AA Sequence: TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GABRB1 gamma-aminobutyric acid (GABA) A receptor, beta 1 [ Homo sapiens ]
• Official Symbol: GABRB1
• Synonyms: GABRB1; gamma-aminobutyric acid (GABA) A receptor, beta 1; gamma-aminobutyric acid receptor subunit beta-1; GABA(A) receptor; beta 1; GABA(A) receptor, beta 1; GABA(A) receptor subunit beta-1
• Gene ID: 2560
• mRNA Refseq: NM_000812
• Protein Refseq: NP_000803
• MIM: 137190
• UniProt ID: P18505