Recombinant Human GABARAPL1, His-tagged

• Cat.No.: GABARAPL1-26548TH
• Product Overview: Recombinant full length Human GABARAPL1 with an N terminal His tag; 137aa, 16.2kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 117 amino acids
• Description: Gamma-aminobutyric acid (GABA) receptor-associated protein-like 1, also known as GABARAPL1, belongs to the MAP1 LC3 family.
• Conjugation: HIS
• Molecular Weight: 16.200kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Gene Information

• Gene Name: GABARAPL1 GABA(A) receptor-associated protein like 1 [ Homo sapiens ]
• Official Symbol: GABARAPL1
• Synonyms: GABARAPL1; GABA(A) receptor-associated protein like 1; gamma-aminobutyric acid receptor-associated protein-like 1; APG8L; ATG8B; ATG8L; gec1
• Gene ID: 23710
• mRNA Refseq: NM_031412
• Protein Refseq: NP_113600
• MIM: 607420
• Uniprot ID: Q9H0R8
• Chromosome Location: 12p13.31
• Pathway: GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: GABA receptor binding; beta-tubulin binding; protein binding