Recombinant Human GABARAP protein, His-tagged

• Cat.No.: GABARAP-6473H
• Product Overview: Recombinant Human GABARAP protein(O95166)(1-116aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 1-116aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.6 kDa
• AASequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GABARAP GABA(A) receptor-associated protein [ Homo sapiens ]
• Official Symbol: GABARAP
• Synonyms: GABARAP; GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; ATG8A; MM46; GABARAP-a; FLJ25768; MGC120154; MGC120155
• Gene ID: 11337
• mRNA Refseq: NM_007278
• Protein Refseq: NP_009209
• MIM: 605125
• UniProt ID: O95166