Recombinant Human GABARAP protein, His-tagged
Cat.No. : | GABARAP-363H |
Product Overview : | Recombinant Human GABARAP protein(O95166)(1-116aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-116aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
Gene Name | GABARAP GABA(A) receptor-associated protein [ Homo sapiens ] |
Official Symbol | GABARAP |
Synonyms | GABARAP; GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; ATG8A; MM46; GABARAP-a; FLJ25768; MGC120154; MGC120155; |
Gene ID | 11337 |
mRNA Refseq | NM_007278 |
Protein Refseq | NP_009209 |
MIM | 605125 |
UniProt ID | O95166 |
◆ Recombinant Proteins | ||
GABARAP-582H | Active Recombinant Human GABARAP Protein, His-tagged Protein, Rhodamine | +Inquiry |
GABARAP-4622H | Recombinant Human GABARAP Protein, GST-tagged | +Inquiry |
GABARAP-6473H | Recombinant Human GABARAP protein, His-tagged | +Inquiry |
GABARAP-2096R | Recombinant Rat GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-939H | Recombinant Human GABARAP Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABARAP Products
Required fields are marked with *
My Review for All GABARAP Products
Required fields are marked with *
0
Inquiry Basket