Recombinant Human G6PC protein, His-sumostar-tagged

Cat.No. : G6PC-5755H
Product Overview : Recombinant Human G6PC protein(P35575)(82-117aa), fused with N-terminal His and sumostar tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Yeast
Species : Human
Tag : N-His-sumostar
Protein length : 82-117aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.5 kDa
AASequence : QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
Official Symbol G6PC
Synonyms G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350;
Gene ID 2538
mRNA Refseq NM_000151
Protein Refseq NP_000142
MIM 613742
UniProt ID P35575

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All G6PC Products

Required fields are marked with *

My Review for All G6PC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon