Recombinant Human G6PC Protein, GST-tagged

• Cat.No.: G6PC-4613H
• Product Overview: Human G6PC full-length ORF ( NP_000142.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 66.9 kDa
• AA Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
• Official Symbol: G6PC
• Synonyms: G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350
• Gene ID: 2538
• mRNA Refseq: NM_000151
• Protein Refseq: NP_000142
• MIM: 613742
• UniProt ID: P35575